AKT2 monoclonal antibody (M05), clone 1F3, Size:100 ug

Katalog Numarası: H00000208-M05

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant AKT2.,
Clone Name:1F3,
Isotype:IgG1 Kappa,
Geneid:20...

Detay

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant AKT2.,
Clone Name:1F3,
Isotype:IgG1 Kappa,
Geneid:208,
Gene Name:AKT2,
Gene Alias:PKBB|PKBBETA|PRKBB|RAC-BETA,
Gene Description:v-akt murine thymoma viral oncogene homolog 2,
Genbank Accession:M95936,
Immunogen:AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII,
Protein Accession:AAA58364,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,Mouse,Rat,
Application Key:WB-Ce,WB-Re,S-ELISA,ELISA,IF

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze