B4GALT5 (Human) Recombinant Protein, Size:10 ug

Katalog Numarası: H00009334-G01

Size:10 ug,
Product Description:Human B4GALT5 full-length ORF (ADR82962.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL)....

Detay

Size:10 ug,
Product Description:Human B4GALT5 full-length ORF (ADR82962.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).,
Clone Name:NONE,
Isotype:NONE,
Geneid:9334,
Gene Name:B4GALT5,
Gene Alias:B4Gal-T5|BETA4-GALT-IV|MGC138470|beta4Gal-T5|beta4GalT-V|gt-V,
Gene Description:UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5,
Genbank Accession:HQ258208.1,
Immunogen:NONE,
Immunogen Sequence Protein Sequence:MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY,
Protein Accession:ADR82962.1,
Supplied Product:NONE,
Form:Liquid,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:in vitro wheat germ expression system with proprietary liposome technology,
Recommend Dilutions:Heating may cause protein aggregation. Please do not heat this product before electrophoresis.,
Storage Buffer:25 mM Tris-HCl of pH8.0 containing 2% glycerol.,
Storage Instruction:Store at -80°C. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:NONE,
Note:Best use within three months from the date of receipt of this protein.,
Tag:None,
Conjugate Tag:NONE,
Type Clonality:Protein,
Raised In Host Species:Wheat Germ (in vitro),
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:NONE,
Application Key:AP

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze