CAMLG polyclonal antibody (A01), Size:50 uL

Katalog Numarası: H00000819-A01

Size:50 uL,
Product Description:Mouse polyclonal antibody raised against a partial recombinant CAMLG.,
Clone Name:NONE,
Isotype:NONE,
Geneid:819,

Detay

Size:50 uL,
Product Description:Mouse polyclonal antibody raised against a partial recombinant CAMLG.,
Clone Name:NONE,
Isotype:NONE,
Geneid:819,
Gene Name:CAMLG,
Gene Alias:CAML|MGC163197,
Gene Description:calcium modulating ligand,
Genbank Accession:NM_001745,
Immunogen:CAMLG (NP_001736, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.,
Immunogen Sequence Protein Sequence:MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQG,
Protein Accession:NP_001736,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:50 % glycerol,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Ce,WB-Re,ELISA

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze