CDK8 monoclonal antibody (M04), clone 2E6, Size:100 ug

Katalog Numarası: H00001024-M04

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant CDK8.,
Clone Name:2E6,
Isotype:IgG1 Kappa,
Geneid:10...

Detay

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant CDK8.,
Clone Name:2E6,
Isotype:IgG1 Kappa,
Geneid:1024,
Gene Name:CDK8,
Gene Alias:K35|MGC126074|MGC126075,
Gene Description:cyclin-dependent kinase 8,
Genbank Accession:NM_001260,
Immunogen:CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY,
Protein Accession:NP_001251,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,Mouse,Rat,
Application Key:WB-Ce,WB-Re,S-ELISA,ELISA

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze