Size:100 uL,
Product Description:Rabbit polyclonal antibody raised against a full-length human CLDN7 protein.,
Clone Name:NONE,
Isotype:NONE,
Geneid...
Size:100 uL,
Product Description:Rabbit polyclonal antibody raised against a full-length human CLDN7 protein.,
Clone Name:NONE,
Isotype:NONE,
Geneid:1366,
Gene Name:CLDN7,
Gene Alias:CEPTRL2|CPETRL2|Hs.84359|claudin-1,
Gene Description:claudin 7,
Genbank Accession:NM_001307.3,
Immunogen:CLDN7 (NP_001298.2, 1 a.a. ~ 211 a.a) full-length human protein.,
Immunogen Sequence Protein Sequence:MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV,
Protein Accession:NP_001298.2,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:No additive,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody reactive against mammalian transfected lysate.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Rabbit,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Tr
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze