COMT MaxPab rabbit polyclonal antibody (D01), Size:100 uL

Katalog Numarası: H00001312-D01

Size:100 uL,
Product Description:Rabbit polyclonal antibody raised against a full-length human COMT protein.,
Clone Name:NONE,
Isotype:NONE,
Geneid:...

Detay

Size:100 uL,
Product Description:Rabbit polyclonal antibody raised against a full-length human COMT protein.,
Clone Name:NONE,
Isotype:NONE,
Geneid:1312,
Gene Name:COMT,
Gene Alias:-,
Gene Description:catechol-O-methyltransferase,
Genbank Accession:NM_007310.1,
Immunogen:COMT (NP_009294.1, 1 a.a. ~ 221 a.a) full-length human protein.,
Immunogen Sequence Protein Sequence:MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP,
Protein Accession:NP_009294.1,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:No additive,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody reactive against mammalian transfected lysate.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Rabbit,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,Mouse,
Application Key:WB-Ti,WB-Tr,IP

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze