Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant CSE1L.,
Clone Name:1E4,
Isotype:IgG1 kappa,
Geneid:1...
Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant CSE1L.,
Clone Name:1E4,
Isotype:IgG1 kappa,
Geneid:1434,
Gene Name:CSE1L,
Gene Alias:CAS|CSE1|MGC117283|MGC130036|MGC130037|XPO2,
Gene Description:CSE1 chromosome segregation 1-like (yeast),
Genbank Accession:NM_001316,
Immunogen:CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL,
Protein Accession:NP_001307,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Ce,WB-Re,S-ELISA,ELISA,IF
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze