Size:2 ug,
Product Description:Human GYPA full-length ORF (AAH13328.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).,
Size:2 ug,
Product Description:Human GYPA full-length ORF (AAH13328.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).,
Clone Name:NONE,
Isotype:NONE,
Geneid:2993,
Gene Name:GYPA,
Gene Alias:CD235a|GPA|GPErik|GPSAT|GpMiIII|HGpMiIII|HGpMiV|HGpMiX|HGpMiXI|HGpSta(C)|MN|MNS,
Gene Description:glycophorin A (MNS blood group),
Genbank Accession:BC013328.1,
Immunogen:NONE,
Immunogen Sequence Protein Sequence:MYGKIIFVLLLSAIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ,
Protein Accession:AAH13328.1,
Supplied Product:NONE,
Form:Liquid,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:in vitro wheat germ expression system with proprietary liposome technology,
Recommend Dilutions:Heating may cause protein aggregation. Please do not heat this product before electrophoresis.,
Storage Buffer:25 mM Tris-HCl of pH8.0 containing 2% glycerol.,
Storage Instruction:Store at -80°C. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:NONE,
Note:Best use within three months from the date of receipt of this protein.,
Tag:None,
Conjugate Tag:NONE,
Type Clonality:Protein,
Raised In Host Species:Wheat Germ (in vitro),
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:NONE,
Application Key:AP
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze