Size:25 ug,
Product Description:Human HOXA10 full-length ORF (ABM86018.1, 1 a.a. - 393 a.a.) recombinant protein with GST tag at N-terminal.,
Clone Name:N...
Size:25 ug,
Product Description:Human HOXA10 full-length ORF (ABM86018.1, 1 a.a. - 393 a.a.) recombinant protein with GST tag at N-terminal.,
Clone Name:NONE,
Isotype:NONE,
Geneid:3206,
Gene Name:HOXA10,
Gene Alias:HOX1|HOX1.8|HOX1H|MGC12859|PL,
Gene Description:homeobox A10,
Genbank Accession:DQ895092.2,
Immunogen:NONE,
Immunogen Sequence Protein Sequence:MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS,
Protein Accession:ABM86018.1,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:in vitro wheat germ expression system,
Recommend Dilutions:NONE,
Storage Buffer:50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.,
Storage Instruction:Store at -80°C. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:12.5% SDS-PAGE Stained with Coomassie Blue,
Note:Best use within three months from the date of receipt of this protein.,
Tag:GST,
Conjugate Tag:NONE,
Type Clonality:Protein,
Raised In Host Species:Wheat Germ (in vitro),
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:NONE,
Application Key:ELISA,WB-Re,AP,Array
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze