HRH4 (Human) Recombinant Protein (Q01), Size:25 ug

Katalog Numarası: H00059340-Q01

Size:25 ug,
Product Description:Human HRH4 partial ORF ( NP_067637, 194 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.,
Clone Name:NONE,...

Detay

Size:25 ug,
Product Description:Human HRH4 partial ORF ( NP_067637, 194 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.,
Clone Name:NONE,
Isotype:NONE,
Geneid:59340,
Gene Name:HRH4,
Gene Alias:AXOR35|BG26|GPCR105|GPRv53|H4|H4R|HH4R|MGC133027,
Gene Description:histamine receptor H4,
Genbank Accession:NM_021624,
Immunogen:NONE,
Immunogen Sequence Protein Sequence:NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS,
Protein Accession:NP_067637,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:in vitro wheat germ expression system,
Recommend Dilutions:NONE,
Storage Buffer:50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.,
Storage Instruction:Store at -80°C. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:12.5% SDS-PAGE Stained with Coomassie Blue.,
Note:Best use within three months from the date of receipt of this protein.,
Tag:GST,
Conjugate Tag:NONE,
Type Clonality:Protein,
Raised In Host Species:Wheat Germ (in vitro),
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:NONE,
Application Key:ELISA,WB-Re,AP,Array

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze