Size:50 uL,
Product Description:Mouse polyclonal antibody raised against a partial recombinant HSD3B7.,
Clone Name:NONE,
Isotype:NONE,
Geneid:80270,...
Size:50 uL,
Product Description:Mouse polyclonal antibody raised against a partial recombinant HSD3B7.,
Clone Name:NONE,
Isotype:NONE,
Geneid:80270,
Gene Name:HSD3B7,
Gene Alias:PFIC4|SDR11E3,
Gene Description:hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,
Genbank Accession:NM_025193,
Immunogen:HSD3B7 (NP_079469, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag.,
Immunogen Sequence Protein Sequence:IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG,
Protein Accession:NP_079469,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:50 % glycerol,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Re,ELISA
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze