Size:50 ug,
Product Description:Mouse polyclonal antibody raised against a full-length human MGC29506 protein.,
Clone Name:NONE,
Isotype:NONE,
Genei...
Size:50 ug,
Product Description:Mouse polyclonal antibody raised against a full-length human MGC29506 protein.,
Clone Name:NONE,
Isotype:NONE,
Geneid:51237,
Gene Name:MGC29506,
Gene Alias:FLJ32987|PACAP,
Gene Description:hypothetical protein MGC29506,
Genbank Accession:BC021275.2,
Immunogen:MGC29506 (NP_057543.2, 1 a.a. ~ 189 a.a) full-length human protein.,
Immunogen Sequence Protein Sequence:MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL,
Protein Accession:NP_057543.2,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody reactive against mammalian transfected lysate.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Tr
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze