Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant MIXL1.,
Clone Name:4D11,
Isotype:IgG2a Kappa,
Geneid...
Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant MIXL1.,
Clone Name:4D11,
Isotype:IgG2a Kappa,
Geneid:83881,
Gene Name:MIXL1,
Gene Alias:MGC138179|MILD1|MIX|MIXL,
Gene Description:Mix1 homeobox-like 1 (Xenopus laevis),
Genbank Accession:NM_031944,
Immunogen:MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP,
Protein Accession:NP_114150,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Re,ELISA
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze