RRM2B monoclonal antibody (M01A), clone 6C1, Size:200 uL

Katalog Numarası: H00050484-M01A

Size:200 uL,
Product Description:Mouse monoclonal antibody raised against a partial recombinant RRM2B.,
Clone Name:6C1,
Isotype:IgG2a Kappa,
Geneid:...

Detay

Size:200 uL,
Product Description:Mouse monoclonal antibody raised against a partial recombinant RRM2B.,
Clone Name:6C1,
Isotype:IgG2a Kappa,
Geneid:50484,
Gene Name:RRM2B,
Gene Alias:DKFZp686M05248|MGC102856|MGC42116|p53R2,
Gene Description:ribonucleotide reductase M2 B (TP53 inducible),
Genbank Accession:NM_015713,
Immunogen:RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD,
Protein Accession:NP_056528,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In ascites fluid,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Re,ELISA

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze