SCMH1 monoclonal antibody (M02), clone 1H2, Size:100 ug

Katalog Numarası: H00022955-M02

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant SCMH1.,
Clone Name:1H2,
Isotype:IgG2a Kappa,
Geneid:...

Detay

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant SCMH1.,
Clone Name:1H2,
Isotype:IgG2a Kappa,
Geneid:22955,
Gene Name:SCMH1,
Gene Alias:Scml3,
Gene Description:sex comb on midleg homolog 1 (Drosophila),
Genbank Accession:NM_012236,
Immunogen:SCMH1 (NP_036368, 404 a.a. ~ 502 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR,
Protein Accession:NP_036368,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Ce,WB-Re,ELISA

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze