TAF5L (Human) Recombinant Protein (P01), Size:25 ug

Katalog Numarası: H00027097-P01

Size:25 ug,
Product Description:Human TAF5L full-length ORF ( NP_001020418.1, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.,
Clone Na...

Detay

Size:25 ug,
Product Description:Human TAF5L full-length ORF ( NP_001020418.1, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.,
Clone Name:NONE,
Isotype:NONE,
Geneid:27097,
Gene Name:TAF5L,
Gene Alias:PAF65B,
Gene Description:TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa,
Genbank Accession:NM_001025247.1,
Immunogen:NONE,
Immunogen Sequence Protein Sequence:MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV,
Protein Accession:NP_001020418.1,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:in vitro wheat germ expression system,
Recommend Dilutions:NONE,
Storage Buffer:50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.,
Storage Instruction:Store at -80°C. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:12.5% SDS-PAGE Stained with Coomassie Blue.,
Note:Best use within three months from the date of receipt of this protein.,
Tag:GST,
Conjugate Tag:NONE,
Type Clonality:Protein,
Raised In Host Species:Wheat Germ (in vitro),
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:NONE,
Application Key:ELISA,WB-Re,AP,Array

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze