Size:25 ug,
Product Description:Purified TNFSF8 (AAH93630.1, 63 a.a. - 234 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed ...
Size:25 ug,
Product Description:Purified TNFSF8 (AAH93630.1, 63 a.a. - 234 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.,
Clone Name:NONE,
Isotype:NONE,
Geneid:944,
Gene Name:TNFSF8,
Gene Alias:CD153|CD30L|CD30LG|MGC138144,
Gene Description:tumor necrosis factor (ligand) superfamily, member 8,
Genbank Accession:BC093630.1,
Immunogen:NONE,
Immunogen Sequence Protein Sequence:QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD,
Protein Accession:AAH93630.1,
Supplied Product:NONE,
Form:Liquid,
Concentration:≥ 10 ug/ml,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:Human HEK293T cells,
Organism:NONE,
Tissue:NONE,
Preparation Method:Transfection of pSuper-TNFSF8 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.,
Recommend Dilutions:NONE,
Storage Buffer:100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.,
Storage Instruction:Store at -80°C. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:SDS-PAGE and Western Blot,
Note:NONE,
Tag:His-Flag-StrepII,
Conjugate Tag:NONE,
Type Clonality:Protein,
Raised In Host Species:Human,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:NONE,
Application Key:WB,ELISA,SDS-PAGE,PI
Bu kategorideki diğer ürünlerimiz.
1000 TL üzeri alişverişler için.
İstanbul/İzmir/Ankara şehirleri için geçerldir.
Çevirim içi/Yüz Yüze