ZNF175 monoclonal antibody (M01), clone 1C2, Size:100 ug

Katalog Numarası: H00007728-M01

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant ZNF175.,
Clone Name:1C2,
Isotype:IgG2a Kappa,
Geneid...

Detay

Size:100 ug,
Product Description:Mouse monoclonal antibody raised against a partial recombinant ZNF175.,
Clone Name:1C2,
Isotype:IgG2a Kappa,
Geneid:7728,
Gene Name:ZNF175,
Gene Alias:OTK18,
Gene Description:zinc finger protein 175,
Genbank Accession:NM_007147,
Immunogen:ZNF175 (NP_009078, 81 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.,
Immunogen Sequence Protein Sequence:KEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRLDADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDP,
Protein Accession:NP_009078,
Supplied Product:NONE,
Form:NONE,
Concentration:NONE,
Target Refseq:NONE,
Target Region:NONE,
Plasmid:NONE,
Formulation:NONE,
Lysis Buffer:NONE,
Host Cell:NONE,
Organism:NONE,
Tissue:NONE,
Preparation Method:NONE,
Recommend Dilutions:NONE,
Storage Buffer:In 1x PBS, pH 7.4,
Storage Instruction:Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.,
Quality Control Testing:Antibody Reactive Against Recombinant Protein.,
Note:NONE,
Tag:NONE,
Conjugate Tag:NONE,
Type Clonality:Antibody,
Raised In Host Species:Mouse,
Antigen Species Target Species:Human,
Specificity:NONE,
Species Reactivity Cross Reactivity:Human,
Application Key:WB-Tr,WB-Re,ELISA,IF

Dökümanlar

  • Ücretsiz Kargo

    1000 TL üzeri alişverişler için.

  • Elden Teslim

    İstanbul/İzmir/Ankara şehirleri için geçerldir.

  • Destek

    Çevirim içi/Yüz Yüze